Proteintech, 67485-1-Ig, S100P Monoclonal antibody

Size: 20ul / 150ul The S100P (67485-1-Ig) by Proteintech is a Monoclonal antibody targeting S100P in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 67485-1-Ig targets S100P in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: BXPC-3 cells Positive IHC detected in: human pancreas cancer tissue, human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:4000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information S100P protein is a relatively small (95 amino acid) isoform of the S100 protein family that was first isolated from human placenta. Overexpression of S100P has been detected in several cancers such as breast, colon, prostate, pancreatic and lung carcinomas, and the protein has been functionally implicated in carcinogenic processes. S100P protein is widely expressed in both normal and neoplastic tissues. It clearly shows ectopic expression in some cancers. Based on the high expression in certain tumors, S100P could represent a potential target for novel diagnostic and therapeutic applications. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19115 Product name: Recombinant human S100P protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-95 aa of BC006819 Sequence: MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK Predict reactive species Full Name: S100 calcium binding protein P Calculated Molecular Weight: 95 aa, 11 kDa Observed Molecular Weight: 10 KDa GenBank Accession Number: BC006819 Gene Symbol: S100P Gene ID (NCBI): 6286 RRID: AB_2882712 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P25815 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.