Proteintech, 67487-1-Ig, MFN2 Monoclonal antibody

Size: 20ul / 150ul The MFN2 (67487-1-Ig) by Proteintech is a Monoclonal antibody targeting MFN2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67487-1-Ig targets MFN2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, LNCaP cells Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information MFN2, also named as CPRP1 and KIAA0214, belongs to the mitofusin family. It is an Essential transmembrane GTPase, which mediates mitochondrial fusion. MFN2 acts independently of the cytoskeleton. It therefore plays a central role in mitochondrial metabolism and may be associated with obesity and/or apoptosis processes. Overexpression of MFN2 induces the formation of mitochondrial networks. It plays an important role in the regulation of vascular smooth muscle cell proliferation. Defects in MFN2 are the cause of Charcot-Marie-Tooth disease type 2A2 (CMT2A2). Defects in MFN2 are the cause of Charcot-Marie-Tooth disease type 6 (CMT6). Ubiquitinated forms of Mfn2 (mono- and polyubiquitinated) are present during mitophagy. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, fish Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29873 Product name: Recombinant human MFN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2-353 aa of BC017061 Sequence: SLLFSRCNSIVTVKKNKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESATFLEDTYRNAELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECISQSA Predict reactive species Full Name: mitofusin 2 Calculated Molecular Weight: 757 aa, 86 kDa Observed Molecular Weight: 86 kDa GenBank Accession Number: BC017061 Gene Symbol: MFN2 Gene ID (NCBI): 9927 ENSEMBL Gene ID: ENSG00000116688 RRID: AB_2882713 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O95140 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.