Proteintech, 67494-1-Ig, ASC/TMS1 Monoclonal antibody

Size: 20ul / 150ul The ASC/TMS1 (67494-1-Ig) by Proteintech is a Monoclonal antibody targeting ASC/TMS1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 67494-1-Ig targets ASC/TMS1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, human placenta tissue, THP-1 cells, U-937 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, THP-1 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information PYCARD , also known as ASC or TMS1, is a 195 amino acid protein containing an N-terminal Pyrin-like domain (PYD) and an 87 residue C-terminal Caspase-associated recruitment domain (CARD). It promotes caspase-mediated apoptosis which is mediated predominantly through the activation of caspase-9. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28424 Product name: Recombinant human TMS1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-135 aa of BC004470 Sequence: MGRARDAILDALENLTAEELKKFKLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS Predict reactive species Full Name: PYD and CARD domain containing Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 22-25 kDa GenBank Accession Number: BC004470 Gene Symbol: ASC/TMS1 Gene ID (NCBI): 29108 RRID: AB_2882718 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9ULZ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.