Proteintech, 67496-1-Ig, HSD17B6 Monoclonal antibody

Size: 20ul / 150ul The HSD17B6 (67496-1-Ig) by Proteintech is a Monoclonal antibody targeting HSD17B6 in WB, IHC, ELISA applications with reactivity to Human samples 67496-1-Ig targets HSD17B6 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: JAR cells, Daudi cells, HuH-7 cells, HepG2 cells, L02 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:100-1:1000 Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17330 Product name: Recombinant human HSD17B6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-317 aa of BC020710 Sequence: MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIGVIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAKFFFIPLSYLPTSLADYILTRSWPKPAQAV Predict reactive species Full Name: hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse) Calculated Molecular Weight: 317 aa, 36 kDa Observed Molecular Weight: 33-35 kDa GenBank Accession Number: BC020710 Gene Symbol: HSD17B6 Gene ID (NCBI): 8630 RRID: AB_2882720 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O14756 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.