Proteintech, 67502-1-Ig, RHOBTB3 Monoclonal antibody

Size: 20ul / 150ul The RHOBTB3 (67502-1-Ig) by Proteintech is a Monoclonal antibody targeting RHOBTB3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples 67502-1-Ig targets RHOBTB3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: K-562 cells, U2OS cells, HEK-293 cells, HeLa cells, Jurkat cells, pig brain tissue Positive IHC detected in: mouse brain tissue, mouse heart tissue, rat adrenal gland tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5782 Product name: Recombinant human RHOBTB3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-359 aa of BC041337 Sequence: MSIHIVALGNEGDTFHQDNQPSGLIRTYLGRSPLVSGDESSLLLNAASTVARPVFTEYQASAFGNVKLVVHDCPVWDIFDSDWYTSRNLIGGADIIVIKYNVNDKFSFHEVKDNYIPVIKRALNSVPVIIAAVGTRQNEELPCTCPLCTSDRGSCVSTTEGIQLAKELGATYLELHSLDDFYIGKYFGGVLEYFMIQALNQKTSEKMKKRKMSNSFHGIRPPQLEQPEKMPVLKAEASHYNSDLNNLLFCCQCVDVVFYNPDLKKVVEAHKIVLCAVSHVFMLLFNVKSPTDIQDSSIIRTTQDLFAINRDTAFPGASHESSGNPPLRVIVKDALFCSCLSDILRFIYSGAFQWEELEE Predict reactive species Full Name: Rho-related BTB domain containing 3 Calculated Molecular Weight: 611 aa, 69 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC041337 Gene Symbol: RHOBTB3 Gene ID (NCBI): 22836 RRID: AB_2882726 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O94955 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.