Iright
BRAND / VENDOR: Proteintech

Proteintech, 67503-1-Ig, CDK5R1 Monoclonal antibody

CATALOG NUMBER: 67503-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CDK5R1 (67503-1-Ig) by Proteintech is a Monoclonal antibody targeting CDK5R1 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat, pig, rabbit samples 67503-1-Ig targets CDK5R1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with Human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: pig cerebellum tissue, pig brain tissue, rat brain tissue, mouse brain tissue, mouse cerebellum tissue Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Cyclin dependent kinase-5 (Cdk5), is an atypical but essential member of the Cdk family of proline-directed serine/threonine kinases. CDK5R1 encodes p35, a specific activator of the serine/threonine kinase CDK5, which plays a central role in neuronal migration and differentiation during central nervous system development. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form. Specification Tested Reactivity: Human, mouse, rat, pig, rabbit Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag13152 Product name: Recombinant human CDK5R1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 99-307 aa of BC020580 Sequence: AQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR Predict reactive species Full Name: cyclin-dependent kinase 5, regulatory subunit 1 (p35) Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC020580 Gene Symbol: CDK5R1 Gene ID (NCBI): 8851 RRID: AB_2882727 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15078 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924