Proteintech, 67506-1-Ig, RBM15B Monoclonal antibody

Size: 20ul / 150ul The RBM15B (67506-1-Ig) by Proteintech is a Monoclonal antibody targeting RBM15B in WB, IHC, ELISA applications with reactivity to human, rat samples 67506-1-Ig targets RBM15B in WB, IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, K-562 cells, COLO 320 cells, LNCaP cells, HEK-293 cells, Jurkat cells, THP-1 cells Positive IHC detected in: human colon cancer tissue, human colon tissue, rat colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information RBM15B, one members of the SPEN (Split-end) family of proteins, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components. Present polyclonal anti-RBM15B antibody was produced by immunizing animals with C-terminus of RBM15B, which homolog with a short form of RBM15B(563aa, ~70kDa). Specification Tested Reactivity: human, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17853 Product name: Recombinant human RBM15B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 490-769 aa of BC001367 Sequence: AKAEETRYPQQYQPSPLPVHYELLTDGYTRHRNLDADLVRDRTPPHLLYSDRDRTFLEGDWTSPSKSSDRRNSLEGYSRSVRSRSGERWGADGDRGLPKPWEERRKRRSLSSDRGRTTHSPYEERSRTKGSGQQSERGSDRTPERSRKENHSSEGTKESSSNSLSNSRHGAEERGHHHHHHEAADSSHGKKARDSERNHRTTEAEPKPLEEPKHETKKLKNLSEYAQTLQLGWNGLLVLKNSCFPTSMHILEGDQGVISSLLKDHTSGSKLTQLKIAQRL Predict reactive species Full Name: RNA binding motif protein 15B Calculated Molecular Weight: 890 aa, 97 kDa Observed Molecular Weight: 105 kDa GenBank Accession Number: BC001367 Gene Symbol: RBM15B Gene ID (NCBI): 29890 RRID: AB_2882729 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8NDT2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.