Iright
BRAND / VENDOR: Proteintech

Proteintech, 67513-1-Ig, PER2 (isoform 1) Monoclonal antibody

CATALOG NUMBER: 67513-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PER2 (isoform 1) (67513-1-Ig) by Proteintech is a Monoclonal antibody targeting PER2 (isoform 1) in WB, IF/ICC, ELISA applications with reactivity to human samples 67513-1-Ig targets PER2 (isoform 1) in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, L02 cells, Y79 cells, BxPC-3 cells, K-562 cells, HL-60 cells, THP-1 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information PER2, also named as KIAA0347, is a component of the circadian clock mechanism which is essential for generating circadian rhythms. Defects in PER2 are a cause of familial advanced sleep-phase syndrome (FASPS) which is characterized by very early sleep onset and offset. There are two isoforms of PER2: isoform 1 has an expected molecular size of about 140 kDa, and 67513-1-Ig detected molecular weight of 150-160 kDa (PMID:16675517), while isoform 2, known as PER2S (a second splicing variant of the human PER2 gene), has a molecular weight of about 45 kDa (PMID:26347774). Specification Tested Reactivity: human Cited Reactivity: human, mouse, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29489 Product name: Recombinant human PER2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 740-839 aa of NM_022817 Sequence: SFLQKFKEIRKLSIFQSHCHYYLQERSKGQPSERTAPGLRNTSGIDSPWKKTGKNRKLKSKRVKPRDSSESTGSGGPVSARPPLVGLNATAWSPSDTSQS Predict reactive species Full Name: period homolog 2 (Drosophila) Calculated Molecular Weight: 137 kDa Observed Molecular Weight: 150~160 kDa GenBank Accession Number: NM_022817 Gene Symbol: PER2 Gene ID (NCBI): 8864 RRID: AB_2882734 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O15055 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924