Iright
BRAND / VENDOR: Proteintech

Proteintech, 67518-1-Ig, HPRT Monoclonal antibody

CATALOG NUMBER: 67518-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HPRT (67518-1-Ig) by Proteintech is a Monoclonal antibody targeting HPRT in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67518-1-Ig targets HPRT in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: mouse liver tissue, human liver cancer tissue, human colon cancer tissue, human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:4000-1:16000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information HPRT, also named HPRT1 and HGPRT, plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutation of HPRT1 is associated with Lesch-Nyhan syndrome (LNS) which is an X-linked inherited neurogenetic disorder of purine metabolism. It has been reported that HPRT1 also plays an important role in HPRT-related gout. 67518-1-Ig antibody detects the protein around 28 kDa in SDS-PAGE. And HPRT1 deficient cell line Sp2/0 was served as a negative control in PTG's results.(PMID:20544509, 28045594, 27379977) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7044 Product name: Recombinant human HPRT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-218 aa of BC000578 Sequence: MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA Predict reactive species Full Name: hypoxanthine phosphoribosyltransferase 1 Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 24-28 kDa GenBank Accession Number: BC000578 Gene Symbol: HPRT1 Gene ID (NCBI): 3251 RRID: AB_2882738 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P00492 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924