Proteintech, 67522-1-Ig, SALL2 Monoclonal antibody

Size: 20ul / 150ul The SALL2 (67522-1-Ig) by Proteintech is a Monoclonal antibody targeting SALL2 in WB, ELISA applications with reactivity to human, mouse, rat samples 67522-1-Ig targets SALL2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, NCCIT cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Sall2 (SALL2, sal-like 2, HSAL2, p150(Sal2)) are mammalian homologs of the Drosophila region-specific home-otic gene spalt (sal), which encodes a zinc finger- containing transcription regulator. Mammalian Sall1 may mediate higher order chromatin structure and may be a component of a distinct heterochromatin-dependent silencing process. Sall2 is a p53-independent regulator of p21 and BAX, and can function in some cell types as a regulator of cell survival. Human Sall2 is present in brain, heart, kidney and pancreas. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30007 Product name: Recombinant human SALL2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-198 aa of BC024245 Sequence: MAHESERSSRLGVPCGEPAELGGDASEEDHPQVCAKCCAQFTDPTEFLAHQNACSTDPPVMVIIGGQENPNNSSASSEPRPEGHNNPQVMDTEHSNPPDSGSSVPTDPTWGPERRGEESPGHFLVAATEPVCGIPVKWPAHEALEFQLHLHYHSKPGPTSAVWPRNCGWEGASNNGIQGSQGEDSPPPISASCTQGSA Predict reactive species Full Name: sal-like 2 (Drosophila) Calculated Molecular Weight: 1007 aa, 105 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: BC024245 Gene Symbol: SALL2 Gene ID (NCBI): 6297 RRID: AB_2882742 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y467 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.