Proteintech, 67541-1-Ig, RBM8A,Y14 Monoclonal antibody

Size: 20ul / 150ul The RBM8A,Y14 (67541-1-Ig) by Proteintech is a Monoclonal antibody targeting RBM8A,Y14 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67541-1-Ig targets RBM8A,Y14 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, 4T1 cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6800 Product name: Recombinant human RBM8A,Y14 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-174 aa of BC017088 Sequence: MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR Predict reactive species Full Name: RNA binding motif protein 8A Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC017088 Gene Symbol: RBM8A Gene ID (NCBI): 9939 RRID: AB_2882760 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9Y5S9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.