Iright
BRAND / VENDOR: Proteintech

Proteintech, 67563-1-Ig, GRP75 Monoclonal antibody

CATALOG NUMBER: 67563-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GRP75 (67563-1-Ig) by Proteintech is a Monoclonal antibody targeting GRP75 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 67563-1-Ig targets GRP75 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, HEK-293 cells, MCF-7 cells, Jurkat cells, K-562 cells, HSC-T6 cells, 4T1 cells, NIH/3T3 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information GRP75 (also known as mortalin, HSPA9 or mt-Hsp70) is a constitutively expressed member of the HSPA (HSP70) family of heat-shock proteins. It is located in the mitochondrial matrix and anti-GRP75 is commonly used as the marker for mitochondria. It has been reported that GRP75 is enriched in cancer cells and contributes to carcinogenesis. In addition, decreased expression level of GRP75 has been found in neurodegenerative disorders like Parkinson's disease. (PMID: 21640711, 229209024) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7125 Product name: Recombinant human GRP75 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 331-679 aa of BC000478 Sequence: YLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ Predict reactive species Full Name: heat shock 70kDa protein 9 (mortalin) Calculated Molecular Weight: 74 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC000478 Gene Symbol: GRP75 Gene ID (NCBI): 3313 RRID: AB_2882777 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P38646 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924