Iright
BRAND / VENDOR: Proteintech

Proteintech, 67567-1-Ig, IGFBP6 Monoclonal antibody

CATALOG NUMBER: 67567-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The IGFBP6 (67567-1-Ig) by Proteintech is a Monoclonal antibody targeting IGFBP6 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 67567-1-Ig targets IGFBP6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-87 MG cells, human testis tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HaCaT cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Insulin-like growth factor (IGF) binding protein (IGFBP6), a 240 amino acid protein, contains an IGFBP N-terminal domain and a thyroglobulin type-1 domain. It modulates the activity of IGF and shows independent effects of IGF, such as growth inhibition and apoptosis. It can decrease the proliferation and survival of cancer cells such as lung cancer cells and naso-pharyngeal cancer cells. IGFBP-6 is distinctive for its 50-fold higher binding affinity for IGF-II over IGF-I and this specificity makes it an attractive potential therapeutic candidate for IGF-II-dependent pediatric malignancies such as rhabdomyosarcoma (RMS). In addition, it was found that IGFBP6 can promote the migration of RMS cells in an IGF-independent manner, and MAPK pathways were involved in this process. Further study reported that IGFBP6 is one of most highly expressed proteins in varicose vein tissues and is involved in the proliferation of vascular smooth muscle cells (VSMCs), which may provide insights into the underlying pathogenesis of varicose vein. Specification Tested Reactivity: human Cited Reactivity: human, monkey Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30050 Product name: Recombinant human IGFBP6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 121-240 aa of BC011708 Sequence: KPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG Predict reactive species Full Name: insulin-like growth factor binding protein 6 Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 30-33 kDa GenBank Accession Number: BC011708 Gene Symbol: IGFBP6 Gene ID (NCBI): 3489 RRID: AB_2882781 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P24592 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924