Iright
BRAND / VENDOR: Proteintech

Proteintech, 67570-1-Ig, MRE11 Monoclonal antibody

CATALOG NUMBER: 67570-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MRE11 (67570-1-Ig) by Proteintech is a Monoclonal antibody targeting MRE11 in WB, ELISA applications with reactivity to human, mouse, rat samples 67570-1-Ig targets MRE11 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, 4T1 cells Recommended dilution Western Blot (WB): WB : 1:3000-1:50000 Background Information Mre11 (meiotic recombination 11), also named as Mre11A, is a component of the MRN( MRE11/RAD50/NBS1) complex which is a versatile complex, playing a key role in the sensing, processing, and repair of DSBs. MRE11 possesses both endonuclease and 3'-5' exonuclease activity. It contains two DNA-binding domains (DBDs), enabling it to bind both single-stranded DNA (ssDNA) and double-stranded DNA (dsDNA). After DSBs, MRE11 is loaded onto DSBs sites and cleaves DNA by cooperating with CtIP (CtBP [C terminal binding protein] interacting protein) to initiate end resection. It's reported that MRE11 is over-expressed in breast cancers. (PMID:38128537; 22914783) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28847 Product name: Recombinant human MRE11A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 170-400 aa of BC063458 Sequence: QKGSTKIALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGSTNFIPEQFLDDFIDLVIWGHEHECKIAPTKNEQQLFYISQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMHKIPLHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERERLGNSHQPEKPLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFR Predict reactive species Full Name: MRE11 meiotic recombination 11 homolog A (S. cerevisiae) Observed Molecular Weight: 81 kDa GenBank Accession Number: BC063458 Gene Symbol: MRE11A Gene ID (NCBI): 4361 RRID: AB_2882784 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P49959 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924