Product Description
Size: 20ul / 150ul
The Serpin A12/Vaspin (67573-1-Ig) by Proteintech is a Monoclonal antibody targeting Serpin A12/Vaspin in WB, IF/ICC, ELISA applications with reactivity to human samples
67573-1-Ig targets Serpin A12/Vaspin in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: human adipose tissue, human placenta tissue
Positive IF/ICC detected in: HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:2000-1:10000
Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600
Background Information
SERPINA12 is also named as Serpin A12 and Visceral adipose tissue-derived serine protease inhibitor (Vaspin). Vaspin is an adipokine belonging to the serpin family, thus also named SERPINA12, with targets in kallikrein 7 and 14 that participates in skin desquamation (PMID: 34359881). Vaspin is a compensatory molecule in obesity and insulin resistance (PMID: 18321232). Vaspin is a newly described adipokine with an insulin sensitizing effect and inhibitory impact on food intake (PMID: 16030142, PMID: 21465327).
Specification
Tested Reactivity: human
Host / Isotype: Mouse / IgG1
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag30136 Product name: Recombinant human SERPINA12 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 275-370 aa of BC040857 Sequence: PDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAG Predict reactive species
Full Name: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12
Calculated Molecular Weight: 414 aa, 47 kDa
Observed Molecular Weight: 47 kDa
GenBank Accession Number: BC040857
Gene Symbol: Vaspin
Gene ID (NCBI): 145264
RRID: AB_2882786
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein G purification
UNIPROT ID: Q8IW75
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924