Proteintech, 67574-1-Ig, TBC1D25 Monoclonal antibody

Size: 20ul / 150ul The TBC1D25 (67574-1-Ig) by Proteintech is a Monoclonal antibody targeting TBC1D25 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67574-1-Ig targets TBC1D25 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NIH/3T3 cells, HeLa cells, HEK-293 cells, Jurkat cells, HSC-T6 cells, Neuro-2a cells Positive IF/ICC detected in: NIH/3T3 cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29470 Product name: Recombinant human TBC1D25 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 32-299 aa of BC101817 Sequence: EREVVRVRVKKCESFLPPEFRSFAVDPQITSLDVLQHILIRAFDLSGKKNFGISYLGRDRLGQEVYLSLLSDWDLSTAFATASKPYLQLRVDIRPSEDSPLLEDWDIISPKDVIGSDVLLAEKRSSLTTAALPFTQSILTQVGRTLSKVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPSLRKVVWRYLLNVYPDGLTGRERMDYMKRKSREYEQLKSEWAQRANPEDLEFIRSTVLKDVLRTDRAH Predict reactive species Full Name: TBC1 domain family, member 25 Observed Molecular Weight: 80 kDa GenBank Accession Number: BC101817 Gene Symbol: TBC1D25 Gene ID (NCBI): 4943 RRID: AB_2882787 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q3MII6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.