Proteintech, 67588-1-Ig, UBAP2L Monoclonal antibody

Size: 20ul / 150ul The UBAP2L (67588-1-Ig) by Proteintech is a Monoclonal antibody targeting UBAP2L in WB, ELISA applications with reactivity to human samples 67588-1-Ig targets UBAP2L in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, K-562 cells, LNCaP cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Ubiquitin-associated protein 2-like (UBAP2L) is a highly conserved protein with an N-terminal ubiquitin-associated (UBA) domain involved in the ubiquitin-proteasome system and aggregate formation induced by proteasome inhibitors. It was originally identified as a human sperm protein that interacts with zona pellucida 3 in human eggs. It can interact with BIM1 to form a complex that modulates hematopoietic stem cell activity. Recent studies have confirmed that UBAP2L function as an oncogene and is associated with various types of cancer, including prostate cancer, glioma, hepatocellular carcinoma (HCC), and colorectal carcinoma. (PMID: 31114027, PMID: 29196913) Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30125 Product name: Recombinant human UBAP2L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 330-488 aa of BC003170 Sequence: GNTFSHHSMVSMLGKGFGDVGEAKGGSTTGSQFLEQFKTAQALAQLAAQHSQSGSTTTSSWDMGSTTQSPSLVQYDLKNPSDSAVHSPFTKRQAFTPSSTMMEVFLQEKSPAVATSTAAPPPPSSPLPSKSTSAPQMSPGSSDNQSSSPQPAHQKLKQQ Predict reactive species Full Name: ubiquitin associated protein 2-like Calculated Molecular Weight: 115 kDa Observed Molecular Weight: 140-160 kDa GenBank Accession Number: BC003170 Gene Symbol: UBAP2L Gene ID (NCBI): 9898 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14157 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.