Iright
BRAND / VENDOR: Proteintech

Proteintech, 67593-1-Ig, Mitoferrin 1 Monoclonal antibody

CATALOG NUMBER: 67593-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Mitoferrin 1 (67593-1-Ig) by Proteintech is a Monoclonal antibody targeting Mitoferrin 1 in WB, ELISA applications with reactivity to Human samples 67593-1-Ig targets Mitoferrin 1 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: human placenta tissue, HepG2 cells, human spleen tissue, K-562 cells, L02 cells, LNCaP cells, TF-1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Mitoferrin (mfrn, SLC25A37), which is highly expressed in fetal and adult hematopoietic tissues, is a member of the vertebrate mitochondrial solute carrier family (SLC25) and is located on the mitochondrial inner membrane. It functions as an essential and high-affinity iron importer for the biosynthesis of mitochondrial heme and iron-sulfur cluster in vertebrate erythroblasts. Additionally, since it was identified as a major depressive disorder (MDD) risk gene, it is likely to be used as a potential biomarker of MDD diagnose. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26216 Product name: Recombinant human SLC25A37 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-44 aa of BC132799 Sequence: MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSAS Predict reactive species Full Name: solute carrier family 25, member 37 Observed Molecular Weight: 40 kDa GenBank Accession Number: BC132799 Gene Symbol: Mitoferrin 1 Gene ID (NCBI): 51312 RRID: AB_2882800 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9NYZ2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924