Proteintech, 67599-1-Ig, PRX5 Monoclonal antibody

Size: 20ul / 150ul The PRX5 (67599-1-Ig) by Proteintech is a Monoclonal antibody targeting PRX5 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, rat samples 67599-1-Ig targets PRX5 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HCT 116 cells, LNCaP cells, HepG2 cells, HeLa cells, Jurkat cells, K-562 cells, HEK-293 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10400 Immunohistochemistry (IHC): IHC : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Peroxiredoxin 5 (Prx5) is a member of a family consisting of six antioxidant enzymes. Prx5 is ubiquitously expressed in various tissues including mitochondria and peroxisomes, implying that Prx5 functions as a regulator of the cellular oxidation state. Prx5 plays a critical role in protecting cells from oxidative stress by inhibiting the accumulation of reactive oxygen species and cell death. Prx5 has an intensive ROS scavenging activity because it is located in the cytosol and mitochondria. Prx5 expression was upregulated during adipogenesis and Prx5 overexpression suppressed adipogenesis by regulating cytosolic and mitochondrial ROS generation. (PMID: 29777756, PMID: 31505325, PMID: 22020876) Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12262 Product name: Recombinant human Prx5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-214 aa of BC110983 Sequence: MGLAGVCALRRSAGYILVGGAGGQSAAAAARRCSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL Predict reactive species Full Name: peroxiredoxin 5 Calculated Molecular Weight: 214 aa, 22 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC110983 Gene Symbol: PRX5 Gene ID (NCBI): 25824 RRID: AB_2882805 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P30044 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.