Iright
BRAND / VENDOR: Proteintech

Proteintech, 67600-1-Ig, SDHB Monoclonal antibody

CATALOG NUMBER: 67600-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SDHB (67600-1-Ig) by Proteintech is a Monoclonal antibody targeting SDHB in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples 67600-1-Ig targets SDHB in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: U2OS cells, HeLa cells, HepG2 cells, HSC-T6 cells, pig brain tissue, HEK-293 cells, K-562 cells, NIH/3T3 cells, Neuro-2a cells, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse skeletal muscle tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver cancer tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information SDHB(Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial) is also named as SDH, SDH1 and belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family. The SDHD, SDHB, and SDHC genes encode subunits of mitochondrial complex II (succinate dehydrogenase). Mitochondrial complex II is a heterotetrameric complex involved in the aerobic electron transport chain and catalyses the oxidation of succinate to fumarate (Krebs cycle) with transport of electrons to the ubiquinone pool. SDHA and SDHB are the hydrophilic catalytic part of the complex and are highly conserved(J Med Genet 2004;41:e99). Defects in SDHB are a cause of susceptibility to pheochromocytoma (PCC), paragangliomas type 4 (PGL4), paraganglioma and gastric stromal sarcoma (PGGSS) and Cowden-like syndrome (CWDLS). Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29868 Product name: Recombinant human SDHB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-280 aa of BC007840 Sequence: MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV Predict reactive species Full Name: succinate dehydrogenase complex, subunit B, iron sulfur (Ip) Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 28-32 kDa GenBank Accession Number: BC007840 Gene Symbol: SDHB Gene ID (NCBI): 6390 RRID: AB_2882806 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P21912 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924