Proteintech, 67610-1-Ig, VPS53 Monoclonal antibody

Size: 20ul / 150ul The VPS53 (67610-1-Ig) by Proteintech is a Monoclonal antibody targeting VPS53 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67610-1-Ig targets VPS53 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: U2OS cells, HEK-293 cells, HeLa cells, NIH/3T3 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, 4T1 cells, LNCaP cells Positive IHC detected in: human liver tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600 Background Information VPS53 is a component of the Golgi-associated retrograde protein (GARP) complex, also called VFT (VPS fifty-three) complex, composed of VPS51, VPS52, VPS53 and VPS54. GARP complex functions in traffic from endosomes to the trans-Golgi network (PMID: 15878329). GARP proteins interact with RAB proteins and SNARE proteins. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29875 Product name: Recombinant human VPS53 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-128 aa of BC029560 Sequence: MVLLDLPSISSQVVRKAPASYTKIVVKGMTRAEMILKVVMAPHEPLVVFVDNYIKLLTDCNTETFQKILDMKGLKRSEQSSMLELLRQRLPAPPSGAESSGSLSLTAPTPEQESSRIRKLEKLIKKRL Predict reactive species Full Name: vacuolar protein sorting 53 homolog (S. cerevisiae) Calculated Molecular Weight: 832 aa, 94 kDa Observed Molecular Weight: 94 kDa GenBank Accession Number: BC029560 Gene Symbol: VPS53 Gene ID (NCBI): 55275 RRID: AB_2882816 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q5VIR6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.