Iright
BRAND / VENDOR: Proteintech

Proteintech, 67620-1-Ig, WASF3 Monoclonal antibody

CATALOG NUMBER: 67620-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The WASF3 (67620-1-Ig) by Proteintech is a Monoclonal antibody targeting WASF3 in IHC, IF-P, ELISA applications with reactivity to Human, Mouse, Rat, Pig, Rabbit samples 67620-1-Ig targets WASF3 in IHC, IF-P, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig, Rabbit samples. Tested Applications Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue, human liver cancer tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information WASF3, also named WAVE3 or SCAR3, belongs to the SCAR/WAVE family. It plays a role in the regulation of cell morphology and cytoskeletal organization. WASF3 is associated with movement, invasion, and metastasis in different cancers such as breast cancer, gastric cancer, and prostate cancer. It has been shown that WASF3 levels are elevated in advanced-stage cancers compared to lower-grade tumors and normal tissue. The 67620-1-Ig antibody recognizes 50-55 kDa and 66-70 kDa proteins similar to the papers.(PMID: 21544801, 15826941, 31038356, 27432794, 31542393) Specification Tested Reactivity: Human, Mouse, Rat, Pig, Rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29991 Product name: Recombinant human WASF3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 212-391 aa of BC050283 Sequence: GIEFMSDAKKLEQAGSAKEDRVPSGSHASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNRPQQPPPPPPPQAPEGSQASAPMAPADYGMLPAQIIEYYNPSGPPPPPPPPVIPSAQTAFVSPLQMPMQPPFPASASSTHAAPPHPPSTGLLVTA Predict reactive species Full Name: WAS protein family, member 3 Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 50-55 and 66-70 kDa GenBank Accession Number: BC050283 Gene Symbol: WASF3 Gene ID (NCBI): 10810 RRID: AB_2882822 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9UPY6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924