Iright
BRAND / VENDOR: Proteintech

Proteintech, 67621-1-Ig, TAF12 Monoclonal antibody

CATALOG NUMBER: 67621-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TAF12 (67621-1-Ig) by Proteintech is a Monoclonal antibody targeting TAF12 in WB, ELISA applications with reactivity to human samples 67621-1-Ig targets TAF12 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information TAF12, also named TAF15 or TAF2J, is a TBP-associated factor that is contained in Pol I- and Pol II-specific TBP-TAF complexes, it is also a component of the transcription factor IID (TFIID) complex, which is essential for mediating regulation of RNA polymerase transcription. TAF12 plays a key role in regulating eukaryotic gene expression by directly binding promoters and enhancer-bound transactivator proteins. Likewise, TAF12 recruits Gadd45a and the nucleotide excision repair complex to the promoter of rRNA genes leading to active DNA demethylation Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16597 Product name: Recombinant human TAF12 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-161 aa of BC011986 Sequence: MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK Predict reactive species Full Name: TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC011986 Gene Symbol: TAF12 Gene ID (NCBI): 6883 RRID: AB_2882823 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q16514 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924