Proteintech, 67623-1-Ig, DIS3L2 Monoclonal antibody

Size: 20ul / 150ul The DIS3L2 (67623-1-Ig) by Proteintech is a Monoclonal antibody targeting DIS3L2 in WB, FC (Intra), ELISA applications with reactivity to human, rat samples 67623-1-Ig targets DIS3L2 in WB, FC (Intra), ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: U2OS cells, HSC-T6 cells, LNCaP cells, Hela cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, NIH/3T3 cells Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information DIS3L2 encodes a protein of 885 amino acids with a predicted molecular weight of 99.3 kDa. Specification Tested Reactivity: human, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29992 Product name: Recombinant human DIS3L2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-170 aa of BC030113 Sequence: AGALGYRERLDMAPDTLQKQADHCNDSRMASKRVQELSTSLFFAVLVKESGPLESEAMVMGILKQAFDVLVLRYGVQKRIYCNALALRSHHFQKVGKKPELTLVWEPEDMEQEPAQQVITIFSLVEVVLQAEYTALKYSAILKRPGTQGHLGPEKEEEESDGEPEDSSTS Predict reactive species Full Name: DIS3 mitotic control homolog (S. cerevisiae)-like 2 Calculated Molecular Weight: 885 aa, 99 kDa Observed Molecular Weight: 65 kDa, 99 kda GenBank Accession Number: BC030113 Gene Symbol: DIS3L2 Gene ID (NCBI): 129563 RRID: AB_2882825 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8IYB7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.