Iright
BRAND / VENDOR: Proteintech

Proteintech, 67625-1-Ig, SORD Monoclonal antibody

CATALOG NUMBER: 67625-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SORD (67625-1-Ig) by Proteintech is a Monoclonal antibody targeting SORD in WB, ELISA applications with reactivity to human, mouse, rat samples 67625-1-Ig targets SORD in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, Hela cells, HepG2 cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information SORD(Sorbitol dehydrogenase) is also named as L-iditol 2-dehydrogenase and belongs to the zinc-containing alcohol dehydrogenase family. It catalyzes the interconversion of polyols and their corresponding ketoses, and together with aldose reductase, makes up the sorbitol pathway that is believed to play an important role in the development of diabetic complications. This protein can form a homotetramer(PMID:12962626). Measurement of SORD is a specific indicator of liver cell damage and parenchymal. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8651 Product name: Recombinant human SORD protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-357 aa of BC021085 Sequence: MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP Predict reactive species Full Name: sorbitol dehydrogenase Calculated Molecular Weight: 357 aa, 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC021085 Gene Symbol: SORD Gene ID (NCBI): 6652 RRID: AB_2882826 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q00796 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924