Proteintech, 67627-1-Ig, CD24 Monoclonal antibody

Size: 20ul / 150ul The CD24 (67627-1-Ig) by Proteintech is a Monoclonal antibody targeting CD24 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 67627-1-Ig targets CD24 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, Raji cells, Ramos cells, Daudi cells, Jurkat cells, K-562 cells, HL-60 cells Positive IF/ICC detected in: Daudi cells Positive FC (Intra) detected in: Ramos cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD24 (known as heat stable antigen) is a small highly glycosylated GPI-linked sialoprotein. It is normally expressed at the surface of most B lymphocytes and differentiating neuroblasts, and it is also up-regulated in a wide variety of cancers. Studies have shown that CD24 functions in the regulation of B-cell apoptosis, leukocyte signal transduction, and leukocyte adhesion. Since it is highly glycosylated, the apparent molecular weight of CD24 could be variable, ranging from 30 kDa to 70 kDa. (Ref: Akihiko Sano, MD., 2009) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag11679 Product name: Recombinant human CD24 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-80 aa of BC007674 Sequence: MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS Predict reactive species Full Name: CD24 molecule Calculated Molecular Weight: 8 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC007674 Gene Symbol: CD24 Gene ID (NCBI): 100133941 RRID: AB_2882828 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P25063 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.