Proteintech, 67631-1-Ig, Ch-TOG Monoclonal antibody

Size: 20ul / 150ul The Ch-TOG (67631-1-Ig) by Proteintech is a Monoclonal antibody targeting Ch-TOG in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 67631-1-Ig targets Ch-TOG in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: pig brain tissue, HeLa cells, HepG2 cells, NCCIT cells, rat brain tissue, mouse brain tissue Positive IHC detected in: mouse cerebellum tissue, human rectal cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:2000-1:8000 Background Information Ch-TOG (colonic hepatic tumor-overexpressed gene), also known as XMAP215 or CKAP5, is a microtubule polymerase which can promotes cytoplasmic microtubule nucleation and elongation. Through interacting with Aurora-A and TACC3, it plays a major role in organizing spindle poles. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28770 Product name: Recombinant human CKAP5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-349 aa of BC120869 Sequence: MGDDSEWLKLPVDQKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIEKGEAVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAVRDEAKLIAVEIYRWIRDALRPPLQNINSVQLKELEEEWVKLPTSAPRPTRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQIDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAV Predict reactive species Full Name: cytoskeleton associated protein 5 Observed Molecular Weight: 220-240 kDa GenBank Accession Number: BC120869 Gene Symbol: Ch-TOG Gene ID (NCBI): 9793 RRID: AB_2882832 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q14008 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.