Iright
BRAND / VENDOR: Proteintech

Proteintech, 67634-1-Ig, GSTM3 Monoclonal antibody

CATALOG NUMBER: 67634-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GSTM3 (67634-1-Ig) by Proteintech is a Monoclonal antibody targeting GSTM3 in WB, IF/ICC, ELISA applications with reactivity to human, pig samples 67634-1-Ig targets GSTM3 in WB, IF/ICC, CoIP, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, pig brain tissue Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information GSTM3 is a cytosolic enzyme involved in prostaglandin and leukotriene synthesis and in the metabolization of toxic compounds, such as chemotherapeutic drugs, insecticides, herbicides, carcinogens, and by-products of oxidative stress. GSTM3 is expressed in testis, brain, lung, and lymphocytes. GSTM3 have been reported to be dysregulated in cancers like prostate cancer and colon cancer. Specification Tested Reactivity: human, pig Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7494 Product name: Recombinant human GSTM3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-225 aa of BC000088 Sequence: MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC Predict reactive species Full Name: glutathione S-transferase mu 3 (brain) Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC000088 Gene Symbol: GSTM3 Gene ID (NCBI): 2947 RRID: AB_2882835 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P21266 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924