Proteintech, 67651-1-Ig, PDLIM5 Monoclonal antibody

Size: 20ul / 150ul The PDLIM5 (67651-1-Ig) by Proteintech is a Monoclonal antibody targeting PDLIM5 in WB, ELISA applications with reactivity to Human samples 67651-1-Ig targets PDLIM5 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: human heart tissue, human platelets Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information PDLIM5 (PDZ and LIM domain 5), formerly known as enigma homolog (ENH), is a cytoplasmic protein containing PDZ domain and LIM domain at N terminus and C terminus, respectively. PDLIM5 gene generates several splicing variants, EZH1 to EZH4. The long isoform, ENH1, is widely expressed in various tissues including heart, brain, spleen, liver and kidney. In comparison, shorter isoforms that lack the LIM motifs are expressed in cardiac (ENH3) and skeletal muscle (ENH2, ENH3, and ENH4). ENH1 is essential for differentiation of striated muscles through interaction with other proteins. In addition, PDLIM5 is also involved in mood disorders, such as schizophrenia, bipolar disorder, and major depression. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgM Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25059 Product name: Recombinant human PDLIM5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 351-596 aa of BC008741 Sequence: PVGSTGVIKSPSWQRPNQGVPSTGRISNSAAYSGSVAPANSALGQTQPSDQDTLVQRAEHIPAGKRTPMCAHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALYCELCYEKFFAPECGRCQRKILGEVINALKQTWHVSCFVCVACGKPIRNNVFHLEDGEPYCETDYYALFGTICHGCEFPIEAGDMFLEALGYTWHDTCFVCSVCCESLEGQTFFSKKDKPLCKKHAHSVNF Predict reactive species Full Name: PDZ and LIM domain 5 Calculated Molecular Weight: 64 kDa Observed Molecular Weight: 63-69 kDa GenBank Accession Number: BC008741 Gene Symbol: PDLIM5 Gene ID (NCBI): 10611 RRID: AB_2882850 Conjugate: Unconjugated Form: Liquid Purification Method: Euglobulin precipitation UNIPROT ID: Q96HC4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.