Proteintech, 67653-1-Ig, CD226 Monoclonal antibody

Size: 20ul / 150ul The CD226 (67653-1-Ig) by Proteintech is a Monoclonal antibody targeting CD226 in WB, ELISA applications with reactivity to Human samples 67653-1-Ig targets CD226 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: human peripheral blood platelets Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information CD226 (DNAM-1) is a ~65 kDa glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. CD226 mediates cellular adhesion of platelets and megakaryocytic cells to vascular endothelial cells. The protein also plays a role in megakaryocytic cell maturation. Interactions of CD226 and its ligands, CD155 and CD112, induce NK and T cell-mediated cytotoxicity and cytokine secretion (PMID: 15039383). Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12403 Product name: Recombinant human CD226 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-254 aa of BC074787 Sequence: MDYPTLLLALLHVYRALCEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTLFVA Predict reactive species Full Name: CD226 molecule Calculated Molecular Weight: 336 aa, 39 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC074787 Gene Symbol: CD226 Gene ID (NCBI): 10666 ENSEMBL Gene ID: ENSG00000150637 RRID: AB_2882852 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q15762 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.