Iright
BRAND / VENDOR: Proteintech

Proteintech, 67656-1-Ig, CYR61/CCN1 Monoclonal antibody

CATALOG NUMBER: 67656-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CYR61/CCN1 (67656-1-Ig) by Proteintech is a Monoclonal antibody targeting CYR61/CCN1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 67656-1-Ig targets CYR61/CCN1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U2OS cells, A431 cells, PC-3 cells, HeLa cells, MDA-MB-231 cells Positive IHC detected in: human liver cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25129 Product name: Recombinant human CYR61 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 165-239 aa of BC001271 Sequence: EDSIKDPMEDQDGLLGKELGFDASEVELTRNNELIAVGKGSSLKRLPVFGMEPRILYNPLQGQKCIVQTTSWSQC Predict reactive species Full Name: cysteine-rich, angiogenic inducer, 61 Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 40-42 kDa GenBank Accession Number: BC001271 Gene Symbol: CYR61 Gene ID (NCBI): 3491 RRID: AB_2882854 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O00622 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924