Proteintech, 67662-1-Ig, HARS Monoclonal antibody

Size: 20ul / 150ul The HARS (67662-1-Ig) by Proteintech is a Monoclonal antibody targeting HARS in WB, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 67662-1-Ig targets HARS in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, NIH/3T3 cells, HSC-T6 cells, Jurkat cells, HEK-293 cells, HepG2 cells, HeLa cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information HARS is a cytoplasmic enzyme that belongs to the class II family of aminoacyl-tRNA synthetases. The enzyme is responsible for the synthesis of histidyl-transfer RNA, which is essential for the incorporation of histidine into proteins. HARS is located in a head-to-head orientation with HARSL on chromosome five, where the homologous genes share a bidirectional promoter. The gene product is a frequent target of autoantibodies in the human autoimmune disease polymyositis/dermatomyositis. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9224 Product name: Recombinant human HARS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-282 aa of BC011807 Sequence: MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQ Predict reactive species Full Name: histidyl-tRNA synthetase Calculated Molecular Weight: 509 aa, 57 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC011807 Gene Symbol: HARS Gene ID (NCBI): 3035 RRID: AB_2882859 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P12081 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.