Proteintech, 67668-1-Ig, Ins1 Monoclonal antibody

Size: 20ul / 150ul The Ins1 (67668-1-Ig) by Proteintech is a Monoclonal antibody targeting Ins1 in IHC, IF-P, ELISA applications with reactivity to mouse, rat samples 67668-1-Ig targets Ins1 in IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive IHC detected in: mouse pancreas tissue, rat pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse pancreas tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:2500-1:10000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information insulin I is a peptide hormone that plays a vital role in the regulation of carbohydrate and lipid metabolism. The encoded precursor protein undergoes proteolytic cleavage to produce a disulfide-linked heterodimeric functional protein that is stored in secretory granules. An increase in blood glucose levels, among others, induces the release of insulin from the secretory granules. Mice deficient in the functional hormone encoded by this gene develop diabetes mellitus. Specification Tested Reactivity: mouse, rat Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29988 Product name: Recombinant mouse insulin1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-87 aa of NM_008386 Sequence: FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKR Predict reactive species Full Name: insulin I Calculated Molecular Weight: 12 kDa GenBank Accession Number: NM_008386 Gene Symbol: Ins1 Gene ID (NCBI): 16333 RRID: AB_2882864 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P01325 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.