Iright
BRAND / VENDOR: Proteintech

Proteintech, 67671-1-Ig, FER Monoclonal antibody

CATALOG NUMBER: 67671-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FER (67671-1-Ig) by Proteintech is a Monoclonal antibody targeting FER in WB, IF/ICC, ELISA applications with reactivity to Human, Mouse, Rat samples 67671-1-Ig targets FER in WB, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: LNCaP cells, ROS1728 cells, 4T1 cells, HEK-293 cells, Hela cells, HepG2 cells, Jurkat cells, K-562 cells, NIH/3T3 cells Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information FER(Tyrosine-protein kinase Fer) is also named as TYK3 and belongs to the protein kinase superfamily. Tyrosine-protein kinase acts downstream of cell surface receptors for growth factors and plays a role in the regulation of the actin cytoskeleton, microtubule assembly, lamellipodia formation, cell adhesion, cell migration and chemotaxis. This protein has 3 isoforms produced by alternative promoter usage and alternative splicing. Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19176 Product name: Recombinant human FER protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 96-445 aa of BC017060 Sequence: PLHRLTMMIKDKQQVKKSYIGVHQQIEAEMIKVTKTELEKLKCSYRQLIKEMNSAKEKYKEALAKGKETEKAKERYDKATMKLHMLHNQYVLALKGAQLHQNQYYDITLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEIVNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFDTSLLEENENLQANEIMWNNLTAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSKFESIRHSIAGIIRSPKSALGSSALS Predict reactive species Full Name: fer (fps/fes related) tyrosine kinase Calculated Molecular Weight: 822 aa, 95 kDa Observed Molecular Weight: 95 kDa GenBank Accession Number: BC017060 Gene Symbol: FER Gene ID (NCBI): 2241 RRID: AB_2882867 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P16591 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924