Iright
BRAND / VENDOR: Proteintech

Proteintech, 67680-1-Ig, NXT1 Monoclonal antibody

CATALOG NUMBER: 67680-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NXT1 (67680-1-Ig) by Proteintech is a Monoclonal antibody targeting NXT1 in WB, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 67680-1-Ig targets NXT1 in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, HeLa cells, HepG2 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NXT1 is located in the nuclear envelope and is homologous to nuclear transport factor 2. NXT1 functions as a nuclear export factor in both RAN (Ras-related nuclear protein)- and CRM1 (required for chromosome region maintenance)-dependent pathways. It is found to stimulate the export of U1 snRNA in RAN- and CRM1-dependent pathways and the export of tRNA and mRNA in a CRM1-independent pathway. NXT1 also heterodimerizes with Tap protein and regulates the ability of Tap protein to mediate nuclear mRNA export. Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30039 Product name: Recombinant human NXT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-140 aa of BC000759 Sequence: MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS Predict reactive species Full Name: NTF2-like export factor 1 Calculated Molecular Weight: 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC000759 Gene Symbol: NXT1 Gene ID (NCBI): 29107 RRID: AB_2882873 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UKK6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924