Proteintech, 67682-1-Ig, PSMD5 Monoclonal antibody

Size: 20ul / 150ul The PSMD5 (67682-1-Ig) by Proteintech is a Monoclonal antibody targeting PSMD5 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, pig, rat, rabbit, mouse samples 67682-1-Ig targets PSMD5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, pig, rat, rabbit, mouse samples. Tested Applications Positive WB detected in: pig liver tissue, rabbit liver tissue, rat liver tissue, K-562 cells, HCT 116 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: Human, pig, rat, rabbit, mouse Host / Isotype: Mouse / IgG3 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19298 Product name: Recombinant human PSMD5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 154-504 aa of BC014478 Sequence: LTQAGLEALFESNLLDDLKSVMKTNDIVRYRVYELIIEISSVSPESLNYCTTSGLVTQLLRELTGEDVLVRATCIEMVTSLAYTHHGRQYLAQEGVIDQISNIIVGADSDPFSSFYLPGFVKFFGNLAVMDSPQQICERYPIFVEKVFEMIESQDPTMIGVAVDTVGILGSNVEGKQVLQKTGTRFERLLMRIGHQSKNAPVELKIRCLDAISSLLYLPPEQQTDDLLRMTESWFSSLSRDPLELFRGISSQPFPELHCAALKVFTAIANQPWAQKLMFNSPGFVEYVVDRSVEHDKASKDAKYELVKALANSKTIAEIFGNPNYLRLRTYLSEGPYYVKPVSTTAVEGAE Predict reactive species Full Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 5 Calculated Molecular Weight: 504 aa, 56 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC014478 Gene Symbol: PSMD5 Gene ID (NCBI): 5711 RRID: AB_2882875 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q16401 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.