Iright
BRAND / VENDOR: Proteintech

Proteintech, 67687-1-Ig, ANP32A Monoclonal antibody

CATALOG NUMBER: 67687-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ANP32A (67687-1-Ig) by Proteintech is a Monoclonal antibody targeting ANP32A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67687-1-Ig targets ANP32A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HSC-T6 cells, HuH-7 cells, HeLa cells, Raji cells, Jurkat cells, Sp2/0 cells Positive IHC detected in: mouse brain tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ANP32A, an acidic leucine-rich nuclear phosphoprotein, is a member of the inhibitor of the histone acetyltransferase (INHAT) complex and preferentially binds to unmodified histone H3 tails in vitro. ANP32A is expressed in normal tissues as well as in pancreatic, breast and prostate cancer and other malignant tumors. ANP32A plays an important role in cell proliferation, apoptosis, transcriptional regulation, signal transduction and other processes. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8546 Product name: Recombinant human ANP32A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-249 aa of BC007200 Sequence: MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD Predict reactive species Full Name: acidic (leucine-rich) nuclear phosphoprotein 32 family, member A Calculated Molecular Weight: 249 aa, 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC007200 Gene Symbol: ANP32A Gene ID (NCBI): 8125 RRID: AB_2882880 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P39687 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924