Proteintech, 67689-1-Ig, ALPK1 Monoclonal antibody

Size: 20ul / 150ul The ALPK1 (67689-1-Ig) by Proteintech is a Monoclonal antibody targeting ALPK1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 67689-1-Ig targets ALPK1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, T-47D cells, A549 cells, U-87 MG cells, Daudi cells, THP-1 cells Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Alpha-protein kinase 1, also known as alpha-kinase 1 (ALPK1), is associated with chronic kidney disease (CKD), myocardial infarction, gout and type 2 diabetes mellitus (DM). ALPK1 mutant has been reported to cause severe defects in motor co‐ordination in mice. ALPK1 enhances the expression of proinflammatory cytokines including IL-1β, IL-8 and TGF-β1 in cultured human THP1 and human embryonic kidney 293 (HEK293) cells (PMID: 31557402, PMID: 26275947). ALPK1 short isoform (108 kDa) was highly expressed in brain, spinal cord, heart, lung, spleen, thymus, small intestine, skin and testis, while detectable inskeletal muscle and kidney. ALPK1 large isoform (130 kDa) appeared in heart, lung, thymus and skin (PMID: 21208416). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5320 Product name: Recombinant human ALPK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-347 aa of BC060780 Sequence: MNNQKVVAVLLQECKQVLDQLLLEAPDVSEEDKSEDQRCRALLPSELRTLIQEAKEMKWPFVPEKWQYKQAVGPEDKTNLKDVIGAGLQQLLASLRASILARDCAAAAAIVFLVDRFLYGLDVSGKLLQVAKGLHKLQPATPIAPQVVIRQARISVNSGKLLKAEYILSSLISNNGATGTWLYRNESDKVLVQSVCIQIRGQILQKLGMWYEAAELIWASIVGYLALPQPDKKGLSTSLGILADIFVSMSKNDYEKFKNNPQINLSLLKEFDHHLLSAAEACKLAAAFSAYTPLFVLTAVNIRGTCLLSYSSSNDCPPELKNLHLCEAKEAFEIGLLTKRDDEPVTG Predict reactive species Full Name: alpha-kinase 1 Calculated Molecular Weight: 139 kDa Observed Molecular Weight: 139 kDa GenBank Accession Number: BC060780 Gene Symbol: ALPK1 Gene ID (NCBI): 80216 RRID: AB_2882882 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q96QP1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.