Proteintech, 67691-1-Ig, FABP2 Monoclonal antibody

Size: 20ul / 150ul The FABP2 (67691-1-Ig) by Proteintech is a Monoclonal antibody targeting FABP2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 67691-1-Ig targets FABP2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: rat small intestine tissue, human jejunum tissue, COLO 320 cells, pig duodenum, mouse small intestine, rabbit small intestine Positive IHC detected in: mouse small intestine tissue, mouse colon tissue, rat small intestine tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse colon tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:50000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information FABP2, also known as the intestinal fatty acid binding protein (I-FABP), is expressed in the absorptive intestinal villus cells. It is mainly involved in intracellular transport and intestinal absorption of lipids. FABP2 has been considered a marker of mucosal injury and ischemia and serum I-FABP level is used as a tissue damage indicator. In addition, it is a marker of differentiated intestinal epithelial cells. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17620 Product name: Recombinant human FABP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-132 aa of BC069617 Sequence: MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD Predict reactive species Full Name: fatty acid binding protein 2, intestinal Calculated Molecular Weight: 132 aa, 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC069617 Gene Symbol: FABP2 Gene ID (NCBI): 2169 RRID: AB_2882884 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P12104 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.