Proteintech, 67693-1-Ig, TRAP1 Monoclonal antibody

Size: 20ul / 150ul The TRAP1 (67693-1-Ig) by Proteintech is a Monoclonal antibody targeting TRAP1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 67693-1-Ig targets TRAP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells Positive IP detected in: K-562 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information TNF receptor-associated protein 1 (TRAP1, synonym: HSP75) is a member of the HSP90 family of molecular chaperones, and is expressed ubiquitously and located to mitochondria. A unique LxCxE motif in HSP75, but not in other HSP90 family members, appears to be important for binding to the simian virus 40 T-antigen-binding domain of hypophosphorylated Rb. Data also suggests that suppression of the expression of TRAP1 in mitochondria plays an important role in the induction of apoptosis caused via formation of reactive oxygen species (ROS). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0400 Product name: Recombinant human TRAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 446-704 aa of BC000406 Sequence: MREGIVTATEQEVKEDIAKLLRYESSALPSGQLTSLSEYASRMRAGTRNIYYLCAPNRHLAEHSPYYEAMKKKDTEVLFCFEQFDELTLLHLREFDKKKLISVETDIVVDHYKEEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVTLRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHALIKKLNQLRASEPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLVKALERH Predict reactive species Full Name: TNF receptor-associated protein 1 Calculated Molecular Weight: 80 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC000406 Gene Symbol: TRAP1 Gene ID (NCBI): 10131 RRID: AB_2882886 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q12931 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.