Proteintech, 67700-1-Ig, SLC6A12 Monoclonal antibody

Size: 20ul / 150ul The SLC6A12 (67700-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC6A12 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67700-1-Ig targets SLC6A12 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: L02 cells, rat liver tissue, HSC-T6 cells, HuH-7 cells, HepG2 cells, mouse hepatocytes Positive IF/ICC detected in: Caco-2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.2 μg per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, canine Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18962 Product name: Recombinant human SLC6A12 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 548-614 aa of BC126215 Sequence: VCVPLFVVITLLKTRGPFRKRLRQLITPDSSLPQPKQHPCLDGSAGRNFGPSPTREGLIAGEKETHL Predict reactive species Full Name: solute carrier family 6 (neurotransmitter transporter, betaine/GABA), member 12 Calculated Molecular Weight: 614 aa, 69 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC126215 Gene Symbol: SLC6A12 Gene ID (NCBI): 6539 RRID: AB_2882892 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P48065 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.