Iright
BRAND / VENDOR: Proteintech

Proteintech, 67711-1-Ig, NARS Monoclonal antibody

CATALOG NUMBER: 67711-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NARS (67711-1-Ig) by Proteintech is a Monoclonal antibody targeting NARS in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 67711-1-Ig targets NARS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HepG2 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, RAW 264.7 cells Positive IHC detected in: human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Asparagine-tRNA ligase (NARS) belongs to the class-II aminoacyl-tRNA synthetase family. Catalyzes the attachment of asparagine to tRNA(Asn) in a two-step reaction: asparagine is first activated by ATP to form Asn-AMP and then transferred to the acceptor end of tRNA(Asn) (PubMed: 9421509). In addition to its essential role in protein synthesis, acts as a signaling molecule that induced migration of CCR3-expressing cells. The NARS levels were higher in tumor tissues compared with adjacent normal tissues, and positively associated with LN metastasis. NARS may serve as a potential biomarker for lung adenocarcinoma (ADC) diagnosis/prognosis (PMID: 27161446). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6656 Product name: Recombinant human NARS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 199-548 aa of BC001687 Sequence: ELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP Predict reactive species Full Name: asparaginyl-tRNA synthetase Calculated Molecular Weight: 63 kDa Observed Molecular Weight: 63 kDa GenBank Accession Number: BC001687 Gene Symbol: NARS Gene ID (NCBI): 4677 RRID: AB_2882901 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O43776 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924