Proteintech, 67714-1-Ig, RHAG Monoclonal antibody

Size: 20ul / 150ul The RHAG (67714-1-Ig) by Proteintech is a Monoclonal antibody targeting RHAG in WB, IHC, IF-P, ELISA applications with reactivity to Human samples 67714-1-Ig targets RHAG in WB, IHC, IF-P, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: human placenta tissue Positive IHC detected in: human placenta tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30130 Product name: Recombinant human RHAG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-53 aa of BC012605 Sequence: MRFTFPLMAIVLEIAMIVLFGLFVEYETDQTVLEQLNITKPTDMGIFFELYPL Predict reactive species Full Name: Rh-associated glycoprotein Calculated Molecular Weight: 409 aa, 44 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC012605 Gene Symbol: RHAG Gene ID (NCBI): 6005 RRID: AB_2882904 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q02094 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.