Proteintech, 67716-1-Ig, CEP290 Monoclonal antibody

Size: 20ul / 150ul The CEP290 (67716-1-Ig) by Proteintech is a Monoclonal antibody targeting CEP290 in WB, ELISA applications with reactivity to Human, rat, mouse samples 67716-1-Ig targets CEP290 in WB, ELISA applications and shows reactivity with Human, rat, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HSC-T6 cells, HeLa cells, NCCIT cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Studies in the Chlamydomonas model system has shown that the ciliary protein CEP290 is a critical component of these Y-link junctions. Additionally, numerous studies have demonstrated that CEP290's function is critical for IFT-in CEP290 knockdown experiments, many proteins that would normally localize to the cilium fail to do so, and cilium formation is disrupted or absent. Mutations in CEP290 are accountable for cases of nephronophthisis, Leber congenital amaurosis and Joubert syndrome. In IF analtsis of HeLa cells, the white arrows show centrosome and cilium staining. Two isoforms were produced by alternative splicing with predicted MW of 290 and 180 kDa according to UniProt. Specification Tested Reactivity: Human, rat, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17457 Product name: Recombinant human CEP290 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-237 aa of BC008641 Sequence: QMDSDEMKKILAENSRKITVLQVNEKSLIRQYTTLVELERQLRKENEKQKNELLSMEAEVCEKIGCLQRFKEMAIFKIAALQKVVDNSVSLSELELANKQYNELTAKYRDILQKDNMLVQRTSNLEHLECENISLKEQVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKKSITNSDIVSISKKITMLEMKELNERQRAEHCQKMYEHLRTSLKQMEERNFELETKFAEV Predict reactive species Full Name: centrosomal protein 290kDa Calculated Molecular Weight: 2479 aa, 290 kDa Observed Molecular Weight: 290 kDa GenBank Accession Number: BC008641 Gene Symbol: CEP290 Gene ID (NCBI): 80184 RRID: AB_2918499 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O15078 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.