Proteintech, 67728-1-Ig, TXNRD1 Monoclonal antibody

Size: 20ul / 150ul The TXNRD1 (67728-1-Ig) by Proteintech is a Monoclonal antibody targeting TXNRD1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67728-1-Ig targets TXNRD1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HSC-T6 cells, A549 cells, PC-12 cells, NIH/3T3 cells, 4T1 cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Thioredoxin reductase-1 (TXNRD1) is uniquely capable of utilizing electrons from NADPH to recover the reduced state of TRX1. Interestingly, TXNRD1 is upregulated in many human malignancies and promotes cancer progression, and attenuation of TXNRD1 levels effectively suppresses the growth of tumor cells (PMID: 31384178). TXNRD1 is also upregulated in many human malignancies and functions as a prognostic factor for many tumors, such as oral squamous cell carcinomas, lung cancer, breast cancer, and astrocytomas. TXNRD1 protein levels were analyzed by inmmunoblotting. Bands of ~55 kDa for TXNRD1 were observed. IHC analysis suggested TXNRD1 was mainly located in the cytoplasm. (PMID: 28536696, PMID: 20584310) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, chicken Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30071 Product name: Recombinant human TXNRD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 199-500 aa of BC018122 Sequence: SYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCUG Predict reactive species Full Name: thioredoxin reductase 1 Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 50-70 kDa GenBank Accession Number: BC018122 Gene Symbol: TXNRD1 Gene ID (NCBI): 7296 RRID: AB_2882914 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q16881 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.