Proteintech, 67737-1-Ig, TNFAIP8 Monoclonal antibody

Size: 20ul / 150ul The TNFAIP8 (67737-1-Ig) by Proteintech is a Monoclonal antibody targeting TNFAIP8 in WB, ELISA applications with reactivity to Human samples 67737-1-Ig targets TNFAIP8 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, K-562 cells, THP-1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information TNFAIP8 (tumor necrosis factor, alpha-induced protein 8), also called SCC-S2/GG2-1/NDED, is associated with enhanced cell survival and inhibition of apoptosis. The induction of TNFAIP8 by TNF depends on the activation of NFκB. TNFAIP8 suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation. TNFAIP8 is expressed in adult spleen, lymph node, thymus, thyroid, bone marrow, and placenta, and in fetal liver, lung, and kidney at high levels, also expressed in various tumor tissues and all cancer cell lines tested. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8805 Product name: Recombinant human TNFAIP8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-198 aa of BC007014 Sequence: MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI Predict reactive species Full Name: tumor necrosis factor, alpha-induced protein 8 Calculated Molecular Weight: 198 aa, 23 kDa Observed Molecular Weight: 19-21 kDa GenBank Accession Number: BC007014 Gene Symbol: TNFAIP8 Gene ID (NCBI): 25816 RRID: AB_2918506 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O95379 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.