Proteintech, 67743-1-Ig, AgBR1 Monoclonal antibody

Size: 20ul / 150ul The AgBR1 (67743-1-Ig) by Proteintech is a Monoclonal antibody targeting AgBR1 in WB, ELISA applications with reactivity to Mosquito samples 67743-1-Ig targets AgBR1 in WB, ELISA applications and shows reactivity with Mosquito samples. Tested Applications Positive WB detected in: Ag30168 Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Background Information AgBR1, a mosquito salivary protein also known as A. aegypti bacteria-responsive protein 1, is found to induce inflammatory responses at the bite site (PMID: 32218189). Various studies suggest that AgBR1 plays a role in transmitting or facilitating infections of several viruses via Aedes aegypti mosquitoes (PMID: 30858571, 31312526). Specification Tested Reactivity: Mosquito Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30168 Product name: Recombinant mosquito AgBR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 240-365 aa of XM_001844620 Sequence: AFLLKDSVEYVHLAAFDQKTPERNPSEADYTSPLYEPTGDGERIAANNVDAEVRYWLTNKTPPNKIVVGIASYGRGWKLPEDSGPVPPVTVDGPSPAGPYTNESGRYSYAEICTQLPGSRLSTLDG Predict reactive species Full Name: AgBR1 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: XM_001844620 Gene Symbol: AgBR1 Gene ID (NCBI): 6034353 RRID: AB_2918512 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: B0W7I8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.