Iright
BRAND / VENDOR: Proteintech

Proteintech, 67745-1-Ig, SKP1 Monoclonal antibody

CATALOG NUMBER: 67745-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SKP1 (67745-1-Ig) by Proteintech is a Monoclonal antibody targeting SKP1 in WB, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 67745-1-Ig targets SKP1 in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information SKP1(S-phase kinase-associated protein 1) is also named as EMC19, OCP2, SKP1A, TCEB1L,belongs to the SKP1 family.It is an essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30709 Product name: Recombinant human SKP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-163 aa of BC009839 Sequence: MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK Predict reactive species Full Name: S-phase kinase-associated protein 1 Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 18-20 kDa GenBank Accession Number: BC009839 Gene Symbol: SKP1 Gene ID (NCBI): 6500 RRID: AB_2918514 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P63208 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924