Iright
BRAND / VENDOR: Proteintech

Proteintech, 67748-1-Ig, PSMB9 Monoclonal antibody

CATALOG NUMBER: 67748-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PSMB9 (67748-1-Ig) by Proteintech is a Monoclonal antibody targeting PSMB9 in WB, IHC, ELISA applications with reactivity to human, rat samples 67748-1-Ig targets PSMB9 in WB, IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: Raji cells, rat spleen tissue, Ramos cells, Daudi cells, HL-60 cells, THP-1 cells Positive IHC detected in: human colon cancer tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information PSMB9, also named as LMP2, PSMB6i and RING12, belongs to the peptidase T1B family. The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. Replacement of PSMB6 by PSMB9 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. High expression of PSMB9 associated with the poor prognosis of patients with NPC. Specification Tested Reactivity: human, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6802 Product name: Recombinant human PSMB9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-219 aa of BC065513 Sequence: MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE Predict reactive species Full Name: proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2) Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 20-23 kDa GenBank Accession Number: BC065513 Gene Symbol: PSMB9 Gene ID (NCBI): 5698 RRID: AB_2918517 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P28065 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924