Proteintech, 67749-1-Ig, CD70 Monoclonal antibody

Size: 20ul / 150ul CD70 Monoclonal Antibody for WB, IHC, IF-P, ELISA 67749-1-Ig targets CD70 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28070 Product name: Recombinant human CD70 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-193 aa of BC000725 Sequence: MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP Predict reactive species Full Name: CD70 molecule Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC000725 Gene Symbol: CD70 Gene ID (NCBI): 970 RRID: AB_2918518 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P32970 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.